PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 432aa    MW: 48364.3 Da    PI: 6.3658
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18523genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like331.4e-10194223131
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPkt 31 
               kpr+ Wt +LH++F+ea++q+ G ++A+Pk+
  EMT18523 194 KPRVTWTIKLHNKFLEAINQI-GLDRAVPKK 223
               79*******************.*******97 PP

2Response_reg75.52e-25231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vdD+++ +++l+ +l++ +y + + ++d++ al++l   ++++Dl+++D++mp+mdG++ll+ ir e  +lp+i+++   ++  + + ++ Ga+
      EMT18523  23 ILVVDDDRVCLKVLEALLRRCNY-QPTPVRDAKTALRMLmaGKQQFDLVITDVRMPDMDGFKLLELIRLEM-DLPVIMISVDCDKRVVMKGIDHGAS 117
                   89*********************.777899999999999555555**********************9976.************************* PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   df +Kp+   el +
      EMT18523 118 DFMVKPVCTHELKN 131
                   ******98888865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.42E-3319141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-3720160No hitNo description
SMARTSM004481.8E-2921133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.24522137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2223131IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.37E-2624136No hitNo description
SuperFamilySSF466891.33E-5191227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-9191223IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-8194223IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGGDRRQMME DAAEDKFPEG LRILVVDDDR VCLKVLEALL RRCNYQPTPV RDAKTALRML  60
MAGKQQFDLV ITDVRMPDMD GFKLLELIRL EMDLPVIMIS VDCDKRVVMK GIDHGASDFM  120
VKPVCTHELK NIWQHVQRWR NPKAISHISD HDNDVQRVQP ATADKSKLSG HKRNAGDDSN  180
KHNESTSIST THRKPRVTWT IKLHNKFLEA INQIGLDRAV PKKKYRLHLK RVNSNPSGDA  240
HERWNSSYNM NNKGNFMHNH EHGRWGASSG DTASWSTNNY GAMGHLAPPM NTQSNFYMGA  300
EAPFISNTTS AGGFTEQMAP FNMASNTSSV GMMLNGSSAL DASRTSTKDT HVVNSERTTS  360
MLHNLQTDDF FSLTQLLDGG DGGSILPMQE GTLDQQPLND QLNEINAFSV DDIFSNMNLE  420
DFTGDDAIVE EA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gt7_A2e-122313810130Sensor protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9962461e-158HE996246.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_12224.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239130.13e-77PREDICTED: two-component response regulator ORR25-like
SwissprotA2X1N26e-69ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8058e-69ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLR7WA950.0R7WA95_AEGTA; Two-component response regulator ARR12
STRINGMLOC_10418.21e-149(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15285415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.17e-62response regulator 10